GraphSol examples

These copy-and-adapt patterns walk a GraphSol job end to end — a single FASTA submission, an API request body, and how to read the probability, call, and warnings columns in the results.

GraphSol examples

Use these patterns to prepare inputs, submit jobs, and read outputs quickly.

Single FASTA submission

>Sample_01
MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQANNNPKATK
>Sample_02
GAMGSYYHHHHHAEIKKYICENSCPSL

• Keep headers short and unique.
• Upload as .fasta or .fasta.gz.
• Default threshold is 0.5; adjust if you need precision or recall tuned.

API submission body

{
  "tool": "graphsol",
  "inputs": {
    "fasta": "https://.../proteins.fasta.gz",
    "threshold": 0.6
  }
}

• Poll GET /api/v1/jobs/{jobId} until succeeded.
• Download results.csv for probabilities and calls.

Reading results

• id: from FASTA header.
• probability: 0–1 solubility score.
• call: soluble/insoluble using current threshold.
• warnings: shows trimmed residues or deduplication notes.

Quick quality check

1. Compare summary.json inputCount vs your FASTA count.
2. Scan warnings column for trimmed or invalid residues.
3. If many sequences cluster near 0.5, consider adjusting threshold offline instead of resubmitting.